SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091Q1T8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091Q1T8
Domain Number 1 Region: 257-313
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000222
Family TSP-1 type 1 repeat 0.002
Further Details:      
 
Domain Number 2 Region: 313-368
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000392
Family TSP-1 type 1 repeat 0.0018
Further Details:      
 
Domain Number 3 Region: 370-418
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000314
Family TSP-1 type 1 repeat 0.0026
Further Details:      
 
Domain Number 4 Region: 204-254
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000196
Family TSP-1 type 1 repeat 0.0027
Further Details:      
 
Domain Number 5 Region: 458-510
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000275
Family TSP-1 type 1 repeat 0.0024
Further Details:      
 
Domain Number 6 Region: 146-192
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000785
Family TSP-1 type 1 repeat 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A091Q1T8
Sequence length 510
Comment (tr|A0A091Q1T8|A0A091Q1T8_LEPDC) Spondin-1 {ECO:0000313|EMBL:KFQ14142.1} KW=Complete proteome; Reference proteome OX=188344 OS=Leptosomus discolor (Madagascar cuckoo roller) (Cuculus discolor). GN=N330_03481 OC=Leptosomus.
Sequence
RAAPSAEFSVDRHRHLMSFLTMLGPSPDWNVGLSAEDLCTKDCGWVQKVVQDLIPWDAGT
DSGVTYESPNKPTVPQEKIRPLTSLDHPQSPFYDPEGGSIKLVARVVIERIARKGEQCNI
VPDNIDDIVADLAPEEKEEDDTPETCIYSNWSPWSACSSSTCEKGKRMRQRMLKAQLDLS
VPCPDTQDFQPCMGPGCSDEDGSTCMMSDWITWSPCSVSCGMGTRSRERYVKQFPEDGSM
CKVPTEETEKCVVNEECSPSSCLVTEWGEWDECSASCGTGMKRRHRMIKMTPADGSMCKA
ETTEAEKCMMPECHTIPCLLSPWSEWSDCSVTCGKGMRTRQRMLKSAAELGDCNEELEQA
EKCMLPECPIDCELTEWSQWSECNTSCGKGHMIRTRMIKIEPQFGGTACPETVQRTKCRV
RKCLRGPGMEKRRWKEAREKRRSEQAKKNIDSEQYPVCRLKPWTAWTECSTLCGGGIQER
YMMVKKRSKSTQFTSCKDKKELRACNVHPC
Download sequence
Identical sequences A0A091Q1T8
XP_009953780.1.99599

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]