SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091Q4P8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091Q4P8
Domain Number 1 Region: 368-514
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 3.39e-25
Family Regulator of G-protein signaling, RGS 0.0025
Further Details:      
 
Domain Number 2 Region: 555-671
Classification Level Classification E-value
Superfamily PX domain 1.83e-24
Family PX domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A091Q4P8
Sequence length 984
Comment (tr|A0A091Q4P8|A0A091Q4P8_LEPDC) Sorting nexin-13 {ECO:0000313|EMBL:KFQ14521.1} KW=Complete proteome; Reference proteome OX=188344 OS=Leptosomus discolor (Madagascar cuckoo roller) (Cuculus discolor). GN=N330_09973 OC=Leptosomus.
Sequence
QTSLSIWGWGSLGLVLFLVTFGPFAIFYFAFYFLCFVGGGFVVTLLFGKSNSEKYLEQCE
HSFLPCTSVGIPKCIEEMKREARPIKIDRRLTGANIIDEPLQQVIQFSLRDYVQYWYYTL
SDDESFLLEVRQALQYALVQFSARSKETDWQPYFTTRLVDDFGTHLRVFRKAQQRIAEKG
DQMKDQAEELVDTFFEVEVEMEKEVCRDLVCTSPKDEEGFLRDLCEVLLYILLPPGDFQN
KIMRYFVREILSRGILLPLINQLSDPDYINQYVIWMIRDSNCNYEAFMNIIKLSDNIGEL
EAVKDKASEELQYLRSLDTAGDDINTIKNQINSLLYVIKVCDSRIQRLQSGKEIDTVKLA
ANFGKLCTVPLDHILVDNVALQFFMDYMQQTGGQAHLFFWMTVEGYRVTAQQQLEVLQSR
QKDGKHQTNQTKGLLRAAAFGVYEQYLSEKASPRVNIDDNLVAKLAETLNHEDPTPEIFD
DIQRKVYELMLRDERFYPSFKQNVLYVRMLAELDMLKDPSFRGSDDGEGESFNGSPTGSI
NLSLDDLSNVPSDETVQLHAYISDTGVCNDHGKTYALYAITVHRRTPNSEETWKTYRRYS
DFHDFHMRITEQFENLANILKLPGKKTFNNMDREFLEKRKKDLNAYLQLLLNPEMMKASP
ALAHYVYDFLENKAYSKGKGDFARKMDTFVNPLRNSMRNVSNAVKSLPDSLAEGMTKMSD
NMGKMSERLGQDIKQSFFKVPPLIQKTYSDPDHCRVAAPIDDNVDDNIPLRVMLLLMDEV
FDLKERNQWLRRNIKNLLQQLIRATYGDTINRYCFSCTERPCELVALIFRKIVDHVDWMT
SPEQVADAVKRFRDAFWPNGILAETVPRRDKAIRMRTRVAGKTKLLEVMPDELKHIIGAE
TTRKGILRVFEMFQHTQLNKRMVYVFLERFLETLFPQNKFHELFNKLHSRSKQMQRYKQR
LHSTQAPSLQKSLLVSHIRLLMHL
Download sequence
Identical sequences A0A091Q4P8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]