SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091QAW9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091QAW9
Domain Number 1 Region: 166-205
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000327
Family TSP-1 type 1 repeat 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A091QAW9
Sequence length 381
Comment (tr|A0A091QAW9|A0A091QAW9_MERNU) Isthmin-2 {ECO:0000313|EMBL:KFQ23044.1} KW=Complete proteome; Reference proteome OX=57421 OS=Merops nubicus (Northern carmine bee-eater). GN=N331_11010 OC=Coelurosauria; Aves; Neognathae; Coraciiformes; Meropidae; Merops.
Sequence
ARSPAVPQPSSARQEESLPFMLDLQSLPGLANMDLSAQNPNIQVTIEVVDDPQAEMEMDL
LKETSNDWSLTSSEWLSHKDLFWPLFWEYTDPTEKEEEEEEEEEEDDNLDVADREEEEEE
EDYTAEYEEEESMLSGVGGDWDQRWPGHKNWIFKEKYNYDDEDEEEWSPWSPCSITCGSG
NQKRTRSCGYACTATESRTCDLPRCPGAKGEMVFPTEETLFKSDNATELFNSELDSCEKW
LNCKSDFLTKYLSKVLTDLPSCPCSYPLEAVYSTVNLQDEQQGKSFRWRDASGPKERLDI
YKPTARFCLRSMLSLDSTTLAAQHCCYDEHTHLITRGKGAGVPNLISTEFSPELHYKVDM
LPWILCKGDWSRYHAVRHPHN
Download sequence
Identical sequences A0A091QAW9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]