SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091QEW1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091QEW1
Domain Number 1 Region: 15-173
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000034
Family SMI1/KNR4-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A091QEW1
Sequence length 274
Comment (tr|A0A091QEW1|A0A091QEW1_HALAL) Tubulin polyglutamylase complex subunit 2 {ECO:0000313|EMBL:KFQ08054.1} KW=Complete proteome; Reference proteome OX=8969 OS=Haliaeetus albicilla (White-tailed sea-eagle). GN=N329_01214 OC=Accipitrinae; Haliaeetus.
Sequence
LLETSPGVTEVTFVEKEPAERHTIISWEQKNSCMLPEDLKNFYLMTDGFQMTWSVKTDDT
PMPLGSMVINSVSKLCRLGGSSMYTLPNAPTLADLEDDTDEEGNGDKPEKPHFDSRSLIF
ELDPCNGNGKVCLVYKHTKPVVSPDTEIWFLDRALYWHFLTKTFTAYYRLLITHLGLPQW
QYAFTSYGVSPQAKQWFNMYKPITINTALLSEEADSFVNKLDPNKVFKSKNKTPVIKKKP
PSQPAGSQKSHMTMTSSKTSSLAGNSSRKRDSQI
Download sequence
Identical sequences A0A091QEW1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]