SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091QFP3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091QFP3
Domain Number 1 Region: 239-368
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 5.5e-44
Family Regulator of G-protein signaling, RGS 0.00000024
Further Details:      
 
Domain Number 2 Region: 1-64
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000000000522
Family DEP domain 0.023
Further Details:      
 
Domain Number 3 Region: 172-229
Classification Level Classification E-value
Superfamily Transducin (heterotrimeric G protein), gamma chain 0.0000000000000732
Family Transducin (heterotrimeric G protein), gamma chain 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A091QFP3
Sequence length 379
Comment (tr|A0A091QFP3|A0A091QFP3_HALAL) Regulator of G-protein signaling 9 {ECO:0000313|EMBL:KFQ08349.1} KW=Complete proteome; Reference proteome OX=8969 OS=Haliaeetus albicilla (White-tailed sea-eagle). GN=N329_09332 OC=Accipitrinae; Haliaeetus.
Sequence
TGNDILQWILQRLQITEEEALHLGDLFVKYGYIYPLQEPKNLTLRRDGSLYRFQTPYFWP
AQSWPADDTDYAIYLAKKNIKRKGILEEYEKEHYNMLNQKINYKWDFVIMQAKEQYKAGK
ERKKADRYALDCQERAYWLVNRTPPGMLNVLEYGLDRATDPNENKVNQKTTMEFYRREIM
YCQQAIMKSRVKSSVSLGGLVKYSEQFLSNDPILSGCLPSNPWVTDDPEFWDLNAKLVEV
PTKMRVERWAFNFSELMRDPKGRQNFQLFLKKEFSGENLSFWEACEDLKYGDQSKVKEKA
EEIYKLFLAPGARRWINIDGTTMGITVKGLKHPHRYVLDAAQTHIYMLMKKDSYGRYLKS
PVYKEMLAKAVVPQETVKK
Download sequence
Identical sequences A0A091QFP3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]