SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091QHW4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091QHW4
Domain Number 1 Region: 187-276
Classification Level Classification E-value
Superfamily Immunoglobulin 6.51e-16
Family I set domains 0.076
Further Details:      
 
Domain Number 2 Region: 28-79
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000249
Family TSP-1 type 1 repeat 0.0019
Further Details:      
 
Domain Number 3 Region: 103-175
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.00000392
Family Pre-dockerin domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A091QHW4
Sequence length 1019
Comment (tr|A0A091QHW4|A0A091QHW4_MERNU) Cartilage intermediate layer protein 1 {ECO:0000313|EMBL:KFQ27145.1} KW=Complete proteome; Reference proteome OX=57421 OS=Merops nubicus (Northern carmine bee-eater). GN=N331_05863 OC=Coelurosauria; Aves; Neognathae; Coraciiformes; Meropidae; Merops.
Sequence
GTRSSSRRGDPIFTYARRSPLMQDSKRFLSPWSKWSECSAKCGQTGVQKRTRSCLAERLW
GVHCNEATEEGRLCIGHLCSACNLTCPMGRVNADCDACMCEDATLHGKVSLEDGSPATDA
RVYLQAKKLKLLTMADNRGMFRIPGVCPDGKNTLKIKKAKYATATVTVPESNRRNLGIHV
QLQRSGKPYVFRSPEDKARRVGQSVALCCEALGSPAPDRYLWYHNGSLLDPSLYKYKNNL
VLKNLNRDHSGEYFCKASSAGGSAKSQPAQLAVIGRQEAPCNSQPQSHLIRLPHDCFQKA
TNSFYYDVGKCPAKTCAGKLDKGLRCKDNVAYCCGVSRMETRDISCDGYTLPTKVAVECG
CKKCTETKITVRGRATAADDGEPMRFGHIYMGNKRVSMTGYKGTFSVHVPADTERLVLTF
VDRLQKFVNTTKVLPFKENGGAVFHEIKLLRKKPPVTLESTETNVISLGEIEEDDPIAEL
EIPPNAFYRKNGEAYRGKVKASVTFLDPRNVSMASVTQSDLNFVDEEGDVFPLRTYGMFS
VDFTDERGAEALNAEEVKVHLDAEQVKIPDHLQEMKLWSLNPETGLWEEEGDFNIEKSRR
RKREERTFLVGNMEIKERRLFNLDVPESRRCYVKVRAYRSERFLQSEQMQGVVVSIINTE
PEPGFSANPRAWGRFDSVVTGANGACVPAFCDEQNPEAYGAYILASLGGEELEAVPSAPK
LNPNAVGVPQPYLNKLNYRRTDHEDSSTKKTAFSINMAKPSPNSPEENNGPIYAYENLKE
CEEAPHSAAHFRFYRIEGDRYDYNTVPFSEDDLMSWTDDYLAWWPKPMEFRACYIKVKIN
GRQEVNVRSRNMGGTHPRTVGKLYGIRDVRSIRDAEQPAVSAACLEFKCSGMLFDQDRVD
RTLVKVVPQGSCRRESVNSMLHEYLVNHLPMATNNDSSEYTMLAPLDPLGHNYGIYTVTD
QDPRIAKEIALGRCFDGTSDGTSRTMKSNVGVGLTFTCSERSAAEQSIFQSQRNSGQQS
Download sequence
Identical sequences A0A091QHW4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]