SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091QIG3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091QIG3
Domain Number 1 Region: 109-200
Classification Level Classification E-value
Superfamily Immunoglobulin 3.24e-16
Family I set domains 0.016
Further Details:      
 
Domain Number 2 Region: 199-249
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000929
Family TSP-1 type 1 repeat 0.00062
Further Details:      
 
Domain Number 3 Region: 787-845
Classification Level Classification E-value
Superfamily DEATH domain 0.000000000000553
Family DEATH domain, DD 0.00019
Further Details:      
 
Domain Number 4 Region: 255-302
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000523
Family TSP-1 type 1 repeat 0.00096
Further Details:      
 
Domain Number 5 Region: 2-104
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000922
Family I set domains 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A091QIG3
Sequence length 846
Comment (tr|A0A091QIG3|A0A091QIG3_9GRUI) Netrin receptor UNC5D {ECO:0000313|EMBL:KFQ26396.1} KW=Complete proteome; Reference proteome OX=54374 OS=Mesitornis unicolor (brown roatelo). GN=N332_05991 OC=Mesitornis.
Sequence
LPHFMEEPDDAYIIKSNPIVLRCKAMPAMQIFFKCNGEWVHQNEHVSEESMDETTGLKVR
EVFINVTRQQVEDFHGPEDYWCQCVAWSHLGTSKSRKASVRIAYLRKNFEQDPQGKEVPI
EGMIVLHCRPPEGVPAAEVEWLKNEEPIDSNLDENIDTRADHNLIIRQARLSDSGNYTCM
AANIVAKRRSMSATVVVYVNGGWSSWTEWSNCNARCGRGWQKRSRTCTNPAPLNGGAFCE
GMSVQKITCTSLCPVDGNWEVWSEWSVCSPECEHLRVRECIAPPPRNGGKYCEGLSQESE
NCTEGLCIQDIETASDIALYSGLGAAVIAVAVLVVGVTLYRRSQSEYGVDVIDSSALTGG
FQTFNFKTVRQGNSLLLNSSLQPELAVSRTYSGPICLQDPMDKELMTESSLFNPLSDIKV
KVQSSFMVSLGVTERAEYHGKAHSGTFPHGNNRAFGTIPARNKATYIQNLPSVSTRSELK
TTAVFGHLGGRLVVPNTGVSLLIPHGAIPEETSWEIYLAITQRESSLQPEGTDVLLGPEV
TCGPSDLSVSAPFALTIPHCAEVNSEHWNIHLKKRTQQGKWEEVMSVEEETTSCYCLLDP
YACHILLNSFGTYALVGEPISDCAVRQLKVAVFGCLSCNSLDYNLRVYCMDNTPCAFQEV
VSDERLQGGQLLEEPKLLHFQGNTFSLQISVLDIPPFLWRIKPFTACQEVPFSRVWSSSQ
TPLHCAFSLERYTPATTQLSCKICVRQVKGHEQILQIHTSILENERETIAFFAHDDSNFP
AQVGPKAFKIPYSIRQRICATFDTPNAKGKDWQMLAQKNSINRNLSYFATQSSPSAVILD
LWEARH
Download sequence
Identical sequences A0A091QIG3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]