SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091QP19 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091QP19
Domain Number 1 Region: 3-87
Classification Level Classification E-value
Superfamily SNARE-like 1.42e-25
Family Synatpobrevin N-terminal domain 0.00000616
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A091QP19
Sequence length 87
Comment (tr|A0A091QP19|A0A091QP19_MERNU) Vesicle-trafficking protein SEC22b {ECO:0000313|EMBL:KFQ28674.1} KW=Complete proteome; Reference proteome OX=57421 OS=Merops nubicus (Northern carmine bee-eater). GN=N331_03426 OC=Coelurosauria; Aves; Neognathae; Coraciiformes; Meropidae; Merops.
Sequence
QSGRDLQHYQSQAKQLFRKLNEQSPTRCTLEAGAMAFHYIIEKGVCYLVLCEAAFPKKLA
FAYLEDLHSEFDEQHGKKVPTVSRPYS
Download sequence
Identical sequences A0A091QP19

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]