SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091QQM4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091QQM4
Domain Number 1 Region: 11-131
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000267
Family Growth factor receptor domain 0.0019
Further Details:      
 
Domain Number 2 Region: 113-165
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000262
Family TSP-1 type 1 repeat 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A091QQM4
Sequence length 176
Comment (tr|A0A091QQM4|A0A091QQM4_MERNU) R-spondin-2 {ECO:0000313|EMBL:KFQ29830.1} KW=Complete proteome; Reference proteome OX=57421 OS=Merops nubicus (Northern carmine bee-eater). GN=N331_00649 OC=Coelurosauria; Aves; Neognathae; Coraciiformes; Meropidae; Merops.
Sequence
ASYGPNPICKGCLSCSKDNGCIRCQHKLFFFLRREGMRQYGECLHSCPSGYYGLRTPDMN
RCSRCRIENCDSCFSRDFCTKCKAGFYSHRGRCFRGCPPGFAALEELMECVEGCEVGQWS
EWGTCSRNNKTCGFKWGLETRTRQIVKKPAKDTIPCPTIAESRRCKMVLRHCPGGK
Download sequence
Identical sequences A0A091QQM4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]