SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091QVV9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091QVV9
Domain Number 1 Region: 188-252
Classification Level Classification E-value
Superfamily Transducin (heterotrimeric G protein), gamma chain 3.01e-19
Family Transducin (heterotrimeric G protein), gamma chain 0.0023
Further Details:      
 
Domain Number 2 Region: 1-70
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 5.44e-18
Family DEP domain 0.023
Further Details:      
 
Domain Number 3 Region: 264-302
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.000000000442
Family Regulator of G-protein signaling, RGS 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A091QVV9
Sequence length 303
Comment (tr|A0A091QVV9|A0A091QVV9_MERNU) Regulator of G-protein signaling 6 {ECO:0000313|EMBL:KFQ30746.1} KW=Complete proteome; Reference proteome OX=57421 OS=Merops nubicus (Northern carmine bee-eater). GN=N331_04545 OC=Coelurosauria; Aves; Neognathae; Coraciiformes; Meropidae; Merops.
Sequence
GADIVQWLMKNLSIEDPAEAIHLGSLIAAQGYVFPISDHVLSLKDDGTFYRFQAPYFWPS
NCWEPENTDYAIYLCKRTMQNKARLELADYEAENLARLQRAFARKWEFIFMQAEAQVKID
RKKDKTERKILDSQERAFWDVHRPVPGCVNTTEMDIRKCRRMKNPQKVKKSVYGVTEESQ
PQSPVHVPSQPVRKTTKEDFRKQITFLNMQIERHCLKMSKVAESLIAYTEQYVEYDPFIT
PAEPSNPWISDDAALWDIEMSKEPSQQRVKRWGFSMDEVLKDPVGRDQFLRFLESEFSSE
NLR
Download sequence
Identical sequences A0A091QVV9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]