SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091QW94 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091QW94
Domain Number 1 Region: 176-216
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000523
Family TSP-1 type 1 repeat 0.00099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A091QW94
Sequence length 419
Comment (tr|A0A091QW94|A0A091QW94_9GRUI) Isthmin-1 {ECO:0000313|EMBL:KFQ31239.1} KW=Complete proteome; Reference proteome OX=54374 OS=Mesitornis unicolor (brown roatelo). GN=N332_12356 OC=Mesitornis.
Sequence
QNTLTADDPSPEDSFTLNPKDKREYPDLQAAHRPFPKQRFRQENGHTSLQRDGPRSFLLD
LPNFPDLSTADINGQNPNIQVTIEVVDGPDTETDKDLQKESSKPSWPVPSPDWRNWWQRS
STLTRMSSGDQDYKYDGTTEDSNFLNPLGGWDSHAPSHRTFESKEQPEYDYIDGEGDWSP
WSLCSVTCGSGNQKRTRSCGYACTATESRTCDRPNCPGIEDTFRTAATEVSLLAGSEDFN
ATKLFEVDTDSCERWMSCKSEFLKKYMHKVVNDLPSCPCSYPREVAYSTAEIYDRIKRKN
FRWKDASGPKEKLEIYKPTARYCIRSMLSLESTTLAAQHCCYDDNMQLITRGKGAGTPNL
ISTEFSAELHYKVDILPWIICKGDWSRYNEARPPNNGQKCTENPSDEDYYKQFQEAREY
Download sequence
Identical sequences A0A091QW94

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]