SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091QWY6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091QWY6
Domain Number 1 Region: 71-202
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.23e-45
Family Regulator of G-protein signaling, RGS 0.00000162
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A091QWY6
Sequence length 210
Comment (tr|A0A091QWY6|A0A091QWY6_9GRUI) Regulator of G-protein signaling 17 {ECO:0000313|EMBL:KFQ32085.1} KW=Complete proteome; Reference proteome OX=54374 OS=Mesitornis unicolor (brown roatelo). GN=N332_08304 OC=Mesitornis.
Sequence
MRKRQQSQNEGTSAVSQAPGNQRPNNTCCFCWCCCCSCSCLTVRNEDRGDNAGRPTHTTK
MESIQVIEECQNPTADEILSWAQNFDKMMKTPAGRNLFREFLRTEYSEENLLFWLACEDL
KKEQNKKVIEEKARLIYEDYISILSPKEVSLDSRVREVINRNLLDPSPHMYEDAQLQIYT
LMHRDSFPRFLNSQIYKSLVESITGSTSET
Download sequence
Identical sequences A0A091FJT0 A0A091H3Z7 A0A091JL55 A0A091Q6X9 A0A091QWY6 A0A091V6E3 A0A091VV92 A0A091X9G0 A0A093H0J9 A0A093T5E7 A0A0A0AF34 G3X8J4 Q9PWA0 R0JJU5
ENSMGAP00000017834 NP_990172.1.86415 XP_003204175.1.16129 XP_005024850.1.99704 XP_009458959.1.38621 XP_009500814.1.22320 XP_009568659.1.62272 XP_009642581.1.23211 XP_009882355.1.48241 XP_009905500.1.92783 XP_009932016.1.35112 XP_009957237.1.99599 XP_009998260.1.85724 XP_010022876.1.70042 XP_010135782.1.100080 XP_010178998.1.17318 XP_010705506.1.16129 XP_014806712.1.91963 XP_015713722.1.68032 XP_015713723.1.68032 XP_021237908.1.32913 XP_021237909.1.32913 XP_021237910.1.32913 XP_021237911.1.32913 ENSGALP00000022103 ENSGALP00000043022 9031.ENSGALP00000022103

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]