SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091R058 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091R058
Domain Number 1 Region: 2-42
Classification Level Classification E-value
Superfamily Virus ectodomain 0.00000000000889
Family Virus ectodomain 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A091R058
Sequence length 60
Comment (tr|A0A091R058|A0A091R058_9GRUI) Uncharacterized protein {ECO:0000313|EMBL:KFQ32296.1} KW=Complete proteome; Reference proteome OX=54374 OS=Mesitornis unicolor (brown roatelo). GN=N332_14785 OC=Mesitornis.
Sequence
AAIDFLLLAQGHGCQDFEGMCCFNLSDHSSSIHQQLAIVQQNMKRISVSSDPFSEWLSNL
Download sequence
Identical sequences A0A091R058

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]