SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091R3N6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091R3N6
Domain Number 1 Region: 2-41
Classification Level Classification E-value
Superfamily Virus ectodomain 0.00000000016
Family Virus ectodomain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A091R3N6
Sequence length 58
Comment (tr|A0A091R3N6|A0A091R3N6_9GRUI) Uncharacterized protein {ECO:0000313|EMBL:KFQ33546.1} KW=Complete proteome; Reference proteome OX=54374 OS=Mesitornis unicolor (brown roatelo). GN=N332_14543 OC=Mesitornis.
Sequence
AAIDFLLLAQGHGCDEFEGMCCMNLSDHSVSIHMKLAVLKEKLHSLKETNDPLGDWLS
Download sequence
Identical sequences A0A091R3N6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]