SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091RB28 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091RB28
Domain Number 1 Region: 1-165
Classification Level Classification E-value
Superfamily p53-like transcription factors 1.18e-66
Family T-box 0.0000000205
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A091RB28
Sequence length 166
Comment (tr|A0A091RB28|A0A091RB28_9GRUI) Uncharacterized protein {ECO:0000313|EMBL:KFQ36437.1} KW=Complete proteome; Reference proteome OX=54374 OS=Mesitornis unicolor (brown roatelo). GN=N332_08078 OC=Mesitornis.
Sequence
LEAKELWEQFHKRGTEMVITKSGRMFPPFKVRCTGLDKKAKYILLMDIVAADDCRYKFHN
SRWMVAGKADPEMPKRMYIHPDSPATGEQWMSKVVTFHKLKLTNNISDKHGFPLLNSMHK
YQPRFHIVRANDILKLPYSTFRTYVFPETEFIAVTAYQNDKVRRLR
Download sequence
Identical sequences A0A091RB28

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]