SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091RFJ3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091RFJ3
Domain Number 1 Region: 1084-1170
Classification Level Classification E-value
Superfamily Immunoglobulin 4.19e-21
Family I set domains 0.034
Further Details:      
 
Domain Number 2 Region: 699-755
Classification Level Classification E-value
Superfamily BPTI-like 6.39e-18
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0023
Further Details:      
 
Domain Number 3 Region: 999-1076
Classification Level Classification E-value
Superfamily Immunoglobulin 1.82e-17
Family I set domains 0.021
Further Details:      
 
Domain Number 4 Region: 867-946
Classification Level Classification E-value
Superfamily Immunoglobulin 8.16e-16
Family I set domains 0.026
Further Details:      
 
Domain Number 5 Region: 368-425
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000222
Family TSP-1 type 1 repeat 0.003
Further Details:      
 
Domain Number 6 Region: 311-369
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000314
Family TSP-1 type 1 repeat 0.0031
Further Details:      
 
Domain Number 7 Region: 430-486
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000127
Family TSP-1 type 1 repeat 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A091RFJ3
Sequence length 1221
Comment (tr|A0A091RFJ3|A0A091RFJ3_9GRUI) Papilin {ECO:0000313|EMBL:KFQ38266.1} KW=Complete proteome; Reference proteome OX=54374 OS=Mesitornis unicolor (brown roatelo). GN=N332_03373 OC=Mesitornis.
Sequence
SFRTEGASSCVGPTRSYRSCNVQSCPEGSRDFRAEQCAEFDETEFQGKKYKWIPYYGAPN
KCELNCIPKGENFYYRHKEAVVDGTTCEPGKRDICVEGVCQAIGCDNMLESAKKEDKCLQ
CGGDGSTCYAVKGTFDVPSLPKGYNQIFIIPVGATSIQIKEVMPSRNFLAVKNVRGEYYL
NGHWTIDFSRALHIASTVMHYDRGSEGDLAPELLHARGPTTEPLIIELISQEPNPGVQYE
YYLPVRGQASGYSWSYGSWRCSPASPLGFQSRLVFCTIDNEIYPDYMCRNKPQPDNNRTC
GRQTCPQTKRWKTGEWGSCSATCGGGTQTRSVYCVAFDGQNSQGVVDNAECMAFAQQPRS
SQPCNMRQCATWSTGPWSECSASCGEGVQTRTVTCRTQQGSQAQDFACLTEPKPSATQPC
LKENCIQEIGWHVGDWGLCSKSCSSGIRTRQVICADGDSKFYSPETCKAIQPQKPATLGS
CNTQPCYLPQLVPSMQDTMGYDVTRQSLLTRYNPNSPATDSGDERMLAGSSTIHSTPGNQ
HIASTNNRGINMLPVRWEFQSRSSGSHQHSLSQDPTAGTDTRDCHRSLHGCCPDGHTPAS
GPLGRGCPFSTCHRSRYGCCPDGVSAAQGPNNIGCPQYYRAVQVSRNQPTEAAPSASQAL
SQQQPSGECRSSMYGCCFDNVASASGPRGEGCLNRPNYPYPVMCLLPSAHGPCTNWTTRW
YFVTVVGKCNRFWYGGCHGNKNSFASEEECMRVCSSGGVGPLEHQPSSGTGALQHQHAGS
RSRTGDARMQGPLEKQGSSGQQVLPQEGKQRHKAFGADVSMTEGFGHQVAADSFPVRALH
REPRGEEDRRGASAIAFSFRTILEEAKPSLVTAVVGQNVQLICKTGLSPFSRVEWMKDGR
PVSSDSHTYQSDSSLVISHVKREDAGTYTCLISDGRMESREIQLQIIGLLVDNSSHEAGC
RSKLPLLPHWSVEIAGLLLVLPHDRALAPEHLLRMDKSEPSVVEANIGERVRLPCTVEAS
PALTVAWQKDGQPLSSPRHRQQSDGALVISRVSAEDRGFFTCIASNGRDQDQHQVLFRPL
GELRITGLLPSITVPEGGTAQLHCTATGNNVNIRWSRNGVPMRADGHRIHLSQDGSLAIS
NVQEADEGSYTCSAYSSSNSVSASTEVKVQRSRPSTAVNHVGDLSRECVDQPHLANCDLI
LQAQLCSNEYYSSFCCASCTR
Download sequence
Identical sequences A0A091RFJ3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]