SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091RI80 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091RI80
Domain Number 1 Region: 159-361
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 4.26e-48
Family Reprolysin-like 0.0022
Further Details:      
 
Domain Number 2 Region: 453-508
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 4.05e-16
Family TSP-1 type 1 repeat 0.00034
Further Details:      
 
Domain Number 3 Region: 869-920
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000051
Family TSP-1 type 1 repeat 0.0034
Further Details:      
 
Domain Number 4 Region: 809-867
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000916
Family TSP-1 type 1 repeat 0.0066
Further Details:      
 
Domain Number 5 Region: 746-805
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000209
Family TSP-1 type 1 repeat 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A091RI80
Sequence length 1104
Comment (tr|A0A091RI80|A0A091RI80_9GRUI) A disintegrin and metalloproteinase with thrombospondin motifs 2 {ECO:0000313|EMBL:KFQ38679.1} KW=Complete proteome; Reference proteome OX=54374 OS=Mesitornis unicolor (brown roatelo). GN=N332_11043 OC=Mesitornis.
Sequence
IFYNVTVFGREFHFRLRPNSRLVAPGATVEWQGDSDETHIEPLYGNCLYVGDITDLPNAS
VAISNCDGLAGMIRTDKDEFFIEPLEKGTQEEEEGGGRTHVVYRRAAAKKQLPIENVDTL
YEAANLTNLDSLDSALSFIEDRVHRSRQRYRRHATDDDYNIEVLLGVDDSVVQFHGKEHV
QKYLLTLMNIVNEIYHDESLGAHINVVLVRIILLSYGKSMSLIEIGNPSQSLENVCRWAY
LQQKPDTGHAEYHDHAIFLTRQDFGPSGMQGYAPVTGMCHPVRSCTLNHEDGFSSAFVVA
HETGHVLGMEHDGQGNRCGDEVRLGSIMAPLVQAAFHRFHWSRCSQQELNRYLHSYDCLR
DDPFEHDWPSLPQLPGIHYSMNEQCRFDFGLGYMMCTAFRTFDPCKQLWCSHPENPYFCK
TKKGPPLDGTMCAPGKHCFKGHCIWLTPDILKQDGHWGAWSKFGSCSRTCGTGVKYRTRQ
CDNPHPANGGRTCVGPSYEFQLCNTQDCPKDFEDFREEQCRQWDPYFEYQNTKHHWLPYE
HVDAKERCHLYCESKETGDVVYMKRMVHDGTRCSYKDPYSICVRGDCLKVGCDRVIGSTK
QEDKCGVCGGDNSHCKVVKGTFSRIPKKQGHIKMFEIPVGARHLLIQETDATSHTLAIKN
RETGKFILSEDNYVPDSKVFIDMGVEWEYRNDDDRETVQTMGPLRNGIVILVIPHGGAKI
SLTYKYMIHEDSLNVDNNNVLEEDSVSYEWALKKWSQCSKPCGGGYQFTKYGCRRKTDHK
MVHRSYCEVIQKPKPVRRVCNLQECSQPIWVTGEWEPCSKSCGKTGYQVRSVRCVQHLHD
NTNRSVHTKYCNNDRPEGRRPCNRELCPAQWRIGPWSQCSVSCGNGTQDRPVLCRTRDNV
VGLCKENKPETVRICRLPPCPRNISDPSKKTYMIQWLSRPDPDYPIQKISSKDHCQGDKS
MFCRMEVLSRYCSIPGYNKLCCKSCNMYSNITEDSNVTDSNVNKNNVIEEELLTTLSPPM
GASTTQSATSPPLVSKTHAPPANATEEHPEINAVDVPYKIDGLDNEVSQHNIITRRRIPY
ERTRNQRIQELIAEKRKKETLRKI
Download sequence
Identical sequences A0A091RI80

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]