SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091RPT0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091RPT0
Domain Number 1 Region: 97-448
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.64e-83
Family Protein kinases, catalytic subunit 0.000000302
Further Details:      
 
Domain Number 2 Region: 2-94
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 9.42e-25
Family Regulator of G-protein signaling, RGS 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A091RPT0
Sequence length 503
Comment (tr|A0A091RPT0|A0A091RPT0_9GRUI) G protein-coupled receptor kinase {ECO:0000256|RuleBase:RU000308} KW=Complete proteome; Reference proteome OX=54374 OS=Mesitornis unicolor (brown roatelo). GN=N332_00924 OC=Mesitornis.
Sequence
AEYEIAPDEKLGEKGKEIMMKYLTPESPAYVPEVSQDLIQQTEEKLENSPCKELFSHCTK
SVLDHLSGEPFQEYLNSMYFDRFLQWKWLERQPVTKNTFRQYRVLGKGGFGEVCACQVRA
TGKMYACKRLEKKRIKKRKGESMALNEKQILEKVNSQFVVNLAYAYETKDALCLVLTIMN
GGDLKFHIYNMGNPGFEEERALFYAAEILCGLEDLHRENTVYRDLKPENILLDDYGHIRI
SDLGLAVKIPEGESIRGRVGTVGYMAPEVLNNQRYTLSPDYWGLGCLIYEMIAGQSPFRG
RKEKVKREEVDRRVLETEEVYSHKFSEEAKSICKMLLTKDVKQRLGCQGEGAAEVKRHPF
FKSMNYKRLEAAMLDPPFVPDPRAVYCKDVLDIEQFSTVKGVNLDQTDDDFYSKFSTGSV
SIPWQNEMIETECFKELNVFGPNGTISPDLNKSYPPEPPKKGLLQRIFKRQHQNNSKSSP
NSKASLNHHINSNHVSSNSTGSS
Download sequence
Identical sequences A0A091RPT0
XP_010177353.1.17318

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]