SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091RVG1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091RVG1
Domain Number 1 Region: 296-424
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 8.9e-43
Family Regulator of G-protein signaling, RGS 0.0000243
Further Details:      
 
Domain Number 2 Region: 1-95
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.29e-29
Family DEP domain 0.013
Further Details:      
 
Domain Number 3 Region: 221-284
Classification Level Classification E-value
Superfamily Transducin (heterotrimeric G protein), gamma chain 1.7e-18
Family Transducin (heterotrimeric G protein), gamma chain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A091RVG1
Sequence length 461
Comment (tr|A0A091RVG1|A0A091RVG1_NESNO) Regulator of G-protein signaling 7 {ECO:0000313|EMBL:KFQ45811.1} KW=Complete proteome; Reference proteome OX=176057 OS=Nestor notabilis (Kea). GN=N333_04572 OC=Coelurosauria; Aves; Neognathae; Psittaciformes; Psittacidae; Nestor.
Sequence
MEDVIARMQDEKNGIPIRTVKSFLSKIPSVFSGSDIVQWLTKNLSIEDPVEALHLGTLMA
AHGYFFPISDHVLTLKDDGTFYRFQTPYFWPSNCWEPENTDYAVYLCKRTMQNKARLELA
DYEAESLARLQRAFARKWEFIFMQAEAQAKVDKKRDKIERKILDSQERAFWDVHRPVPGC
VNTTEVDIKKSSRMRNPHKTRKSVYGLQNDIRSHSPTHTPVPETKPPTEDELHEEIKHWQ
MQLDRHRLKMSKVAESLLAYTEQYLEYDPFLVPPDPSNPWISDDTTFWELEASKEPGQQR
VKRWGFGMDEALKDPVGREQFLKFLESEFSSENLRFWLAVEDLKKRPIREVPARVQEIWQ
EFLAPGAPSAINLDSKSYDKTTQNVKDPGRYTFEDAQEHIYKLMKSDSYPRFIRSSAYQE
LLQAKKKLENTLDRRTSFEKFTRNVGKSLTSKRLTSLVQSY
Download sequence
Identical sequences A0A091RVG1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]