SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091S4Q0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091S4Q0
Domain Number 1 Region: 16-131
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 9.42e-21
Family Regulator of G-protein signaling, RGS 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A091S4Q0
Sequence length 157
Comment (tr|A0A091S4Q0|A0A091S4Q0_NESNO) Regulator of G-protein signaling 22 {ECO:0000313|EMBL:KFQ51569.1} KW=Complete proteome; Reference proteome OX=176057 OS=Nestor notabilis (Kea). GN=N333_06906 OC=Coelurosauria; Aves; Neognathae; Psittaciformes; Psittacidae; Nestor.
Sequence
QHANNKCVSSSSEVIAFRKALLNPVTANEFQRFVSLQGDLLENGVLFWQEVQKYKDLCHS
HCDDATIQKKITAIIDCFINSAIPPALQIDIPMEQAKKILEHRRDLGPYIFREAQMSIFA
LLFKFWPKFCKLQSNLASDKILLALERRKGKKMQKKE
Download sequence
Identical sequences A0A091S4Q0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]