SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091SEB6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091SEB6
Domain Number 1 Region: 11-203
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.18e-32
Family Ankyrin repeat 0.00055
Further Details:      
 
Domain Number 2 Region: 225-270
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000732
Family SOCS box-like 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A091SEB6
Sequence length 272
Comment (tr|A0A091SEB6|A0A091SEB6_9GRUI) Ankyrin repeat and SOCS box protein 1 {ECO:0000313|EMBL:KFQ38625.1} KW=Complete proteome; Reference proteome OX=54374 OS=Mesitornis unicolor (brown roatelo). GN=N332_09876 OC=Mesitornis.
Sequence
SRINEKSVWCCGWLPCTPLRIAATAGHGPCVDFLLRKGAEIDLVDVKGQTALYVAVVNGH
LECAKILLEAGADPNGSRHHRSTPVYHAARVGRADILRELIRYGADVDVNHHLPSRVPSL
SLRPLTTLVVCPLYISAAYHNLQCFRLLLQAGANPDFNCCGPINIQGFSRGSPVCVMDAV
LRHGCEAAFVHLLIDFGANLNLVKAEALGVESTGRVKINPEALQVFKEARGHTRSLLSLC
RIAVRRILGKSRLDLIHILPIPDPIKQFLLHE
Download sequence
Identical sequences A0A091SEB6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]