SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091SQG3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091SQG3
Domain Number 1 Region: 2-121
Classification Level Classification E-value
Superfamily EF-hand 9.42e-36
Family Osteonectin 0.0097
Further Details:      
 
Domain Number 2 Region: 90-182
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 2.35e-28
Family Thyroglobulin type-1 domain 0.00063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A091SQG3
Sequence length 238
Comment (tr|A0A091SQG3|A0A091SQG3_NESNO) Testican-3 {ECO:0000313|EMBL:KFQ45212.1} KW=Complete proteome; Reference proteome OX=176057 OS=Nestor notabilis (Kea). GN=N333_10635 OC=Coelurosauria; Aves; Neognathae; Psittaciformes; Psittacidae; Nestor.
Sequence
VCSDLEFREVANRLRDWFKALHESGIQNKKTRIVQRPERTRFDTSILPICKDSLGWMFNR
LDTNYDLLLDQSELGSIYLDKNEPCTRAFFNSCDTYKDSLISNNEWCYCFQRQQDPPCQT
ELSNIQKQQGGKKLPGQYIPLCDEDGYYKPSQCHGSAGQCWCVDRYGNEVTGSRTNGAAE
CAIDIETSGDFASGDFHEWTDDEDDEDEIMNDEDEIEDDDEDEGDDDVDDDDDHDGYI
Download sequence
Identical sequences A0A091SQG3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]