SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091SQL4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091SQL4
Domain Number 1 Region: 110-141
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.000000628
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A091SQL4
Sequence length 180
Comment (tr|A0A091SQL4|A0A091SQL4_9AVES) Uncharacterized protein C3orf30 {ECO:0000313|EMBL:KFQ60982.1} KW=Complete proteome; Reference proteome OX=36300 OS=Pelecanus crispus (Dalmatian pelican). GN=N334_07230 OC=Pelecanus.
Sequence
VETPASADQPSVVELPVSADRLVVEKPPGSEDQLPVIEFPASRENSHEIGSLVGDFPGFK
VKMCVPDSGQAGSKTPEAGSSVTLVKATETTCEILEQPMVYEDPFEVSIKYMEKHNILQI
FQEITEKLVYQKPDDPLQFMLLQVQSMMNARQAEMEGTLEENEDAEVFLEEVLCTPFGPY
Download sequence
Identical sequences A0A091SQL4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]