SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091SRF4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091SRF4
Domain Number 1 Region: 93-143
Classification Level Classification E-value
Superfamily HIT/MYND zinc finger-like 0.00000000227
Family MYND zinc finger 0.01
Further Details:      
 
Weak hits

Sequence:  A0A091SRF4
Domain Number - Region: 3-33
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 0.004
Family Intron-encoded homing endonucleases 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A091SRF4
Sequence length 154
Comment (tr|A0A091SRF4|A0A091SRF4_NESNO) Zinc finger MYND domain-containing protein 19 {ECO:0000313|EMBL:KFQ45552.1} KW=Complete proteome; Reference proteome OX=176057 OS=Nestor notabilis (Kea). GN=N333_05935 OC=Coelurosauria; Aves; Neognathae; Psittaciformes; Psittacidae; Nestor.
Sequence
ERHRGGIAPGFQVVHLNSVTVDNRLDNLRLVPWGWKPKAEDISSKQREQSLYWLAIQQLP
TDPIEEQFPVLNVTRYYNANGDVVEEEENSCTYYECHYPPCTMIEKQLREFNICGRCQVA
RYCGSQCQQKDWPAHKKHCREKKRTFQQELGPER
Download sequence
Identical sequences A0A091SRF4 H0ZZH5
ENSTGUP00000016029 ENSTGUP00000016029 59729.ENSTGUP00000016029

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]