SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091STG8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091STG8
Domain Number 1 Region: 118-240
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.19e-34
Family cAMP-binding domain 0.000000903
Further Details:      
 
Domain Number 2 Region: 15-62
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 1.83e-19
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00023
Further Details:      
 
Domain Number 3 Region: 243-296
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.000000000102
Family cAMP-binding domain 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A091STG8
Sequence length 297
Comment (tr|A0A091STG8|A0A091STG8_9AVES) cAMP-dependent protein kinase type I-beta regulatory subunit {ECO:0000313|EMBL:KFQ61972.1} KW=Complete proteome; Reference proteome OX=36300 OS=Pelecanus crispus (Dalmatian pelican). GN=N334_13596 OC=Pelecanus.
Sequence
MAAASSCNVEEDESLKGCELYVQKHNIQQILKECIVNLCIAKPDRPMKFLREHFEKLEKE
ECKQILARQKSSSQSDSHDDEISPPPPNPVVKARRRRGGVSAEVYTEEDAVSYVRKVIPK
DYKTMTALAKAISKNVLFAHLDDNERSDIFDAMFPVTHIAGETVIQQGDEGDNFYVIDQG
EVDVYVNGEWVTSIGEGGSFGELALIYGTPRAATVKAKTDLKLWGIDRDSYRRILMGSTL
RKRKMYEEFLSKVSILESLDKWERLTVADALEPVQFEDGEKIVVQGEPGDDFFIITE
Download sequence
Identical sequences A0A091STG8 A0A094K2E8
XP_009482630.1.14425 XP_010163227.1.30499

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]