SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091SV21 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091SV21
Domain Number 1 Region: 247-375
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 7.07e-43
Family Regulator of G-protein signaling, RGS 0.0000243
Further Details:      
 
Domain Number 2 Region: 172-235
Classification Level Classification E-value
Superfamily Transducin (heterotrimeric G protein), gamma chain 8.37e-19
Family Transducin (heterotrimeric G protein), gamma chain 0.0026
Further Details:      
 
Domain Number 3 Region: 2-53
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000000185
Family DEP domain 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A091SV21
Sequence length 412
Comment (tr|A0A091SV21|A0A091SV21_9AVES) Regulator of G-protein signaling 7 {ECO:0000313|EMBL:KFQ62183.1} KW=Complete proteome; Reference proteome OX=36300 OS=Pelecanus crispus (Dalmatian pelican). GN=N334_08280 OC=Pelecanus.
Sequence
VEALHLGTLMAAHGYFFPISDHVLTLKDDGTFYRFQTPYFWPSNCWEPENTDYAVYLCKR
TMQNKARLELADYEAESLARLQRAFARKWEFIFMQAEAQAKVDKKRDKIERKILDSQERA
FWDVHRPVPGCVNTTEVDIKKSSRMRNPHKTRKSVYGLQNDIRSHSPTHTPVPETKPPTE
DELHQEIKHWQMQLDRHRLKMSKVAESLLAYTEQYLEYDPFLVPPDPSNPWISDDTTFWE
LEASKEPGQQRVKRWGFGMDEALKDPVGREQFLKFLESEFSSENLRFWLAVEDLKKRPIR
EVPARVQEIWQEFLAPGAPSAINLDSKSYDKTTQNVKDPGRYTFEDAQEHIYKLMKSDSY
PRFIRSSAYQELLQAKKKLENTLDRRTSFEKFTRNVGKSLTSKRLTSLVQSY
Download sequence
Identical sequences A0A091SV21

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]