SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091SZ22 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091SZ22
Domain Number 1 Region: 2-98
Classification Level Classification E-value
Superfamily Nucleoplasmin-like core domain 2.09e-33
Family Nucleoplasmin-like core domain 0.00000744
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A091SZ22
Sequence length 273
Comment (tr|A0A091SZ22|A0A091SZ22_9AVES) Nucleophosmin {ECO:0000313|EMBL:KFQ63275.1} KW=Complete proteome; Reference proteome OX=36300 OS=Pelecanus crispus (Dalmatian pelican). GN=N334_12287 OC=Pelecanus.
Sequence
LKADKEYQFKVDDEENEHQLSLRTASIVTLGAGAKDELHVVEAEALDYEGNPVKVVLASL
KMSVQPTVSLGGFEITPPVVLRLKCGSGPVYVSGQHLVALEEEPESDDEEDDTKIVNTST
KRPASGGGAKTPQKKAKLSEDDEEDDEDEEEDDDDEDDLEDDEEEMKTPMKKPVREASGK
NMQKAKQNGKDSKPSTPASKSKTPDSKKDKSLTPKTPKVPLSLEEIKAKMQASVDKGSSL
PKLEPKFANYVKNCFRTEDQKVIQALWQWRQTL
Download sequence
Identical sequences A0A091SZ22

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]