SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091T3X5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091T3X5
Domain Number 1 Region: 69-171
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.3e-31
Family Spermadhesin, CUB domain 0.00081
Further Details:      
 
Domain Number 2 Region: 5-66
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.29e-16
Family Complement control module/SCR domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A091T3X5
Sequence length 172
Comment (tr|A0A091T3X5|A0A091T3X5_PHALP) CUB and sushi domain-containing protein 2 {ECO:0000313|EMBL:KFQ69056.1} KW=Complete proteome; Reference proteome OX=97097 OS=Phaethon lepturus (White-tailed tropicbird). GN=N335_04057 OC=Phaethon.
Sequence
LPSHTCGNPGRLQNGIQQGTTFSIGDKVRYSCNPGFFLEGHALLTCHANSENSASWDFPL
PFCRADDACGGTLRGQSGIISSPHFPLEYGNNADCTWTILAEPGDTIALVFMDFQLEDGY
DVLEVAGTEGSSLWFTGMNLPAPVISSKNWLRLHFTSDGNHRQKGFSAQYQG
Download sequence
Identical sequences A0A091M4C2 A0A091T3X5 A0A091VLI7 A0A091XKM2 A0A093FPC8 A0A094N7D9 A0A0A0AUT2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]