SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091TNJ1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091TNJ1
Domain Number 1 Region: 3-125
Classification Level Classification E-value
Superfamily Ricin B-like lectins 8.48e-20
Family Cysteine rich domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A091TNJ1
Sequence length 158
Comment (tr|A0A091TNJ1|A0A091TNJ1_PHALP) Uncharacterized protein {ECO:0000313|EMBL:KFQ79086.1} KW=Complete proteome; Reference proteome OX=97097 OS=Phaethon lepturus (White-tailed tropicbird). GN=N335_01778 OC=Phaethon.
Sequence
AEGQGFLIRNTRLEKCISVCHHETNGISLTDCKVHSRQQQWSWDRTTRTIVSLQRKQCLS
AHKTREYALVKLEPCGDWERQAWSCSKKGHLTLQGLGFHLSTKEGGHKVFVSREKDKFSR
WKTLADETICAAAQTAAPRPSKPMPQAVDTHVWIYESK
Download sequence
Identical sequences A0A091TNJ1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]