SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091TSM2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091TSM2
Domain Number 1 Region: 1-109
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 9.94e-40
Family Regulator of G-protein signaling, RGS 0.0000198
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A091TSM2
Sequence length 110
Comment (tr|A0A091TSM2|A0A091TSM2_9AVES) Regulator of G-protein signaling 5 {ECO:0000313|EMBL:KFQ61681.1} KW=Complete proteome; Reference proteome OX=36300 OS=Pelecanus crispus (Dalmatian pelican). GN=N334_11076 OC=Pelecanus.
Sequence
PDGLTSFRSFLRSEFSEENAEFWVACEDYKKTKSPVKMAEKARKIYEEFIQTEAPKEVNI
DHFTKAVTMKNLVEPSPSSFDMAQKRIFALMEKDSLPRFVRSEFYQELIK
Download sequence
Identical sequences A0A091TSM2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]