SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091TVD5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091TVD5
Domain Number 1 Region: 41-170
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.1e-47
Family Regulator of G-protein signaling, RGS 0.00000473
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A091TVD5
Sequence length 170
Comment (tr|A0A091TVD5|A0A091TVD5_PHORB) Regulator of G-protein signaling 8 {ECO:0000313|EMBL:KFQ82384.1} KW=Complete proteome; Reference proteome OX=9218 OS=Phoenicopterus ruber ruber. GN=N337_04769 OC=Phoenicopteridae; Phoenicopterus.
Sequence
LPHIDHRNRGMRTRLGCLSHKSDSYNDFTAILPDKPNWALKRLSTEEATRWADSFDVLLS
HKYGLAAFRAFLKTEFSEENLEFWLACEDFKKTRSAAKVASKAQRIFEEFIDVQAPREVN
IDFQTRELTRRNMQEPSLSCFDQAQGKVHSLMEKDSYPRFLRSKIYTDLL
Download sequence
Identical sequences A0A091TVD5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]