SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091TWG3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091TWG3
Domain Number 1 Region: 12-116
Classification Level Classification E-value
Superfamily Prefoldin 0.0000000000262
Family Prefoldin 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A091TWG3
Sequence length 127
Comment (tr|A0A091TWG3|A0A091TWG3_PHALP) Prefoldin subunit 4 {ECO:0000313|EMBL:KFQ82581.1} KW=Complete proteome; Reference proteome OX=97097 OS=Phaethon lepturus (White-tailed tropicbird). GN=N335_09930 OC=Phaethon.
Sequence
AAEDVNVTFEDQQKINKFARNTSRITELKEEIEVKKKQLQNLEDACDDIMMLDDGDSLLI
PYQIGDVFISHSQEETQEMLEEAKKSLQEEIEALESRVESIQRVLSDLKVQLYAKFGNNI
NLEAEDS
Download sequence
Identical sequences A0A087V8W8 A0A091M4L4 A0A091NVJ3 A0A091TWG3 A0A093QXT8 A0A094L821 A0A0A0B3R1 R0M616
XP_010293044.1.48707 XP_010297017.1.13389

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]