SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091TX15 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091TX15
Domain Number 1 Region: 3-161
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 5.5e-44
Family DBL homology domain (DH-domain) 0.0000000757
Further Details:      
 
Domain Number 2 Region: 165-291
Classification Level Classification E-value
Superfamily PH domain-like 2.07e-36
Family Pleckstrin-homology domain (PH domain) 0.000000435
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A091TX15
Sequence length 292
Comment (tr|A0A091TX15|A0A091TX15_PHORB) Guanine nucleotide exchange factor DBS {ECO:0000313|EMBL:KFQ82312.1} KW=Complete proteome; Reference proteome OX=9218 OS=Phoenicopterus ruber ruber. GN=N337_02638 OC=Phoenicopteridae; Phoenicopterus.
Sequence
LQGYAAEMDNPLMAHLISPELQNKKDILFGNMEEIYHFHNRIFLRELEKYVEYPELVGRC
FLDQMEDFQIYEKYCQNKPRSESLWRQFSDSVFFQECQRKLDHKLSLDSYLLKPVQRITK
YQLLLKEMLKYSKNCEGAEDLQEALTSILGILKAVNDSMHQIAITGYDGNLNELGKLLMQ
GSFNVWTDHKKGHSKVKDLARFKPMQRHLFLHEKAVLFCKKREENGEGYEKAPSYSYKHS
LNMAAVGITENVKGDAKKFEIWYNAREEVYIIQAPTPEVKATWVNEIRKVLT
Download sequence
Identical sequences A0A091TX15

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]