SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091U4N7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091U4N7
Domain Number 1 Region: 21-86
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 3.33e-17
Family Ovomucoid domain III-like 0.00069
Further Details:      
 
Domain Number 2 Region: 89-151
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000000025
Family Ovomucoid domain III-like 0.0002
Further Details:      
 
Domain Number 3 Region: 159-207
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000000887
Family Ovomucoid domain III-like 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A091U4N7
Sequence length 207
Comment (tr|A0A091U4N7|A0A091U4N7_PHORB) Ovomucoid {ECO:0000313|EMBL:KFQ84825.1} KW=Complete proteome; Reference proteome OX=9218 OS=Phoenicopterus ruber ruber. GN=N337_12928 OC=Phoenicopteridae; Phoenicopterus.
Sequence
MTTAGVFVLLSFALCCFPDAAFGVEVDCSTYPNTTNEEGKEVLVCTKVVSPICGTDGVTY
SNECLLCAYNIEYGTNISKDHDGKCKEVVPVDCSRYPNTTNEEGKVVLPCNKDLSPVCGT
DGVTYDNECLLCTRNLEPGTSVGKKYDGECKKEIASVDCSDYPKPVCSLEHMPLCGSDSQ
TYSNKCNFCNAVMDSNGTLTLSHFGKC
Download sequence
Identical sequences A0A091U4N7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]