SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091U4R7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091U4R7
Domain Number 1 Region: 1-155
Classification Level Classification E-value
Superfamily p53-like transcription factors 1.57e-53
Family STAT DNA-binding domain 0.00034
Further Details:      
 
Domain Number 2 Region: 156-261
Classification Level Classification E-value
Superfamily SH2 domain 3.5e-34
Family SH2 domain 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A091U4R7
Sequence length 264
Comment (tr|A0A091U4R7|A0A091U4R7_PHORB) Signal transducer and transcription activator 6 {ECO:0000313|EMBL:KFQ85421.1} KW=Complete proteome; Reference proteome OX=9218 OS=Phoenicopterus ruber ruber. GN=N337_09944 OC=Phoenicopteridae; Phoenicopterus.
Sequence
KGSESVTEEKCAVLFSTTVALTPSNLSIHLQVLSLPIVVIVHGNQDNNAKATVLWDNAFS
EIDRVPFVVAERVPWEKMCDTLNLKFMAEVQTTKGLLKEHYFFLAQKIFNDHSASLEDFQ
SRSVSWAQFNKEILPGRGFTFWQWFDGVLDLTKRCLKSYWSDRLIIGFISKQYVCKLLST
EPDGTFLLRFSDSEIGGVTIAHVIRGKDGSSQVENIQPFSAKDLSIRSLGDRIRDLGQLR
NLYPNTPKDQAFGSHYNKEQTGKD
Download sequence
Identical sequences A0A091U4R7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]