SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091U9D6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091U9D6
Domain Number 1 Region: 522-650
Classification Level Classification E-value
Superfamily PX domain 1.7e-21
Family PX domain 0.0024
Further Details:      
 
Domain Number 2 Region: 285-432
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 2.65e-19
Family Regulator of G-protein signaling, RGS 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A091U9D6
Sequence length 905
Comment (tr|A0A091U9D6|A0A091U9D6_PHALP) Sorting nexin-14 {ECO:0000313|EMBL:KFQ70663.1} KW=Complete proteome; Reference proteome OX=97097 OS=Phaethon lepturus (White-tailed tropicbird). GN=N335_00898 OC=Phaethon.
Sequence
LFIRYLHILMIFWSFVAGVFTFYCSLGPDSLLPNILFTIKYKPKQLELPELFPHGHSCAV
CGKVKCKRHRPALLLENYQPWLDLKVPSKVDASLSEVLELVLENFIYPWYRNITDDESSV
DELRGTLRFFASVLVRRIHKVDIPTVVTKKMLKAAMKHIEVIAKARQKVKNVEFLQQAAL
EEYGPELHVALRSRRDELHYLRKLTELLFPYILPPKSTECRSLALLIREILPGSVFLPSM
DFLADPDTVNHLLLIFIDDSPPEKATEPTSSLVPFLQKFAEPRNKKPSVLKLELKEIRDQ
QDLLFRFMNFLKQEGAVHVLQFCLTVEEFNDRILRPELSDTEKVSLHEEVQKIYKTYCLD
ESIDKIRFDPFIVEEIQRIAEGPYMDVVKLQTMRCLFEAYEXXXXXSLLENVFTPMFCHS
DEYFRHLLRGAESPTRNSKFNRSSLSLDDFRTTQKRGESFGISRIGNKIKGVFKSSAMEG
AMLPNYNLNDGEDDFIEEGVMVMEDDSPEEAVSTPNTPRNLAAWKISIPYVDFFDDPSLE
RKDRKERIPVFCIDVERNDRRAVGHEPEHWSVYRRYLEFYVLESKLTEFHGTFPDAQLPS
KRIIGPKNYEFLKSKREEFQEYLQKLLQHPELSNSQLLADFLSPNGGETQFLDKMLPDVN
LGKIIKSVPGKLMKEKGQHLEPFIMNFINSCESPKPKPSRPELTILSPTSENNKKLFNDL
FKNNANRSENTERRQNQNYFMEMMTVEGVYDYLMYVGRVVFRIPDWLHHLLMGGRILFKN
TLELYTDYYLHYKLEQLFQEHRLVSLITLLRDAVFCENTEPRSLQDKQKRAKQTFEEMMR
YIPDLIGKCIGEEAKYEGIRLLFDGMQQPVLNKQLTYVLLDIGIQELFPELSKGPKEASS
ASCWM
Download sequence
Identical sequences A0A091U9D6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]