SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091UAH7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091UAH7
Domain Number 1 Region: 162-280
Classification Level Classification E-value
Superfamily PH domain-like 5.53e-37
Family Third domain of FERM 0.00000942
Further Details:      
 
Domain Number 2 Region: 65-163
Classification Level Classification E-value
Superfamily Second domain of FERM 2.09e-34
Family Second domain of FERM 0.00000651
Further Details:      
 
Domain Number 3 Region: 2-53
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.31e-17
Family First domain of FERM 0.00077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A091UAH7
Sequence length 281
Comment (tr|A0A091UAH7|A0A091UAH7_PHORB) Band 4.1-like 3 {ECO:0000313|EMBL:KFQ86870.1} KW=Complete proteome; Reference proteome OX=9218 OS=Phoenicopterus ruber ruber. GN=N337_08053 OC=Phoenicopteridae; Phoenicopterus.
Sequence
QKRSRGQVLFDKVCEHLNLLEKDYFGLTYRDTENQKNWLDPAKEIKKQIRSKFEASMKSP
VPGKPPCSLYYLCLQLRDDIVSGRLPCSFVTLALLGSYTVQSELGDYDPDEYGSDYISEF
RFAPNHTKELEDKVIELHKSHRGMTPAEAEMHFLENAKKLSMYGVDLHHAKDSEGVEIML
GVCASGLLIYRDRLRINRFAWPKVLKISYKRNNFYIKIRPGEFEQFESTIGFKLPNHRAA
KRLWKVCVEHHTFFRLLLPEAPPKKFLTLGSKFRYSGRTQA
Download sequence
Identical sequences A0A091UAH7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]