SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091UHY0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091UHY0
Domain Number 1 Region: 165-246
Classification Level Classification E-value
Superfamily HMG-box 6.41e-22
Family HMG-box 0.00000521
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A091UHY0
Sequence length 297
Comment (tr|A0A091UHY0|A0A091UHY0_PHORB) Transcription factor 7-like 2 {ECO:0000313|EMBL:KFQ89295.1} KW=Complete proteome; Reference proteome OX=9218 OS=Phoenicopterus ruber ruber. GN=N337_08695 OC=Phoenicopteridae; Phoenicopterus.
Sequence
SNKVPVVQHPHHVHPLTPLITYSNEHFTPGNPPPHLPADVDPKTGIPRPPHPPDISPYYP
LSPGTVGQIPHPLGWLVPQQGQPVYPITTGGFRHPYPTALTVNASMSRFPPHMVPPHHSL
HTTGIPHPAIVTPTVKQESSQSDVGSLHSSKHQDSKKEEEKKKPHIKKPLNAFMLYMKEM
RAKVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYG
KKKKRKRDKQPGETNEHSECFLNPCLSLPPITDLSAPKKCRARFGLDQQNNWCGPCR
Download sequence
Identical sequences A0A087V677 A0A091M6N1 A0A091PU76 A0A091SEZ4 A0A091TWL8 A0A091UHY0 A0A093C602 A0A093IB59 A0A093IVC3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]