SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091UIG8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091UIG8
Domain Number 1 Region: 2-53
Classification Level Classification E-value
Superfamily SAM/Pointed domain 2.03e-22
Family Pointed domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A091UIG8
Sequence length 54
Comment (tr|A0A091UIG8|A0A091UIG8_PHORB) Transcription factor ETV7 {ECO:0000313|EMBL:KFQ90316.1} KW=Complete proteome; Reference proteome OX=9218 OS=Phoenicopterus ruber ruber. GN=N337_03365 OC=Phoenicopteridae; Phoenicopterus.
Sequence
IQPSLWSKDDVIHWLRWAEKEYSLRQTHESKFEMNGKALCILTKDDFRYRAPSS
Download sequence
Identical sequences A0A091UIG8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]