SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091UL60 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091UL60
Domain Number 1 Region: 100-185
Classification Level Classification E-value
Superfamily DEATH domain 0.0000000051
Family DEATH domain, DD 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A091UL60
Sequence length 193
Comment (tr|A0A091UL60|A0A091UL60_NIPNI) Ectodysplasin-A receptor-associated adapter protein {ECO:0000313|EMBL:KFQ91092.1} KW=Complete proteome; Reference proteome OX=128390 OS=Nipponia nippon (Crested ibis) (Ibis nippon). GN=Y956_00201 OC=Nipponia.
Sequence
TSVSLAFLLQTEKYPVQDTGVPKDEEYLTDQVTLEIASVNIKTLTSDSGLIQQPEDKDTQ
NHSDESLSDLKKTCKENGTCSLCLFRAPTISDMLNDEDLLYTVRLKLDPCHPTVKNWRNL
ASKWGMTYDELCFLEQKPQSPTLEFLLRNSDRTVEQLIDLCKFYKRMDVVKVLLKWVEEE
WPKRGNRTYQNDF
Download sequence
Identical sequences A0A091UL60

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]