SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091UQB9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091UQB9
Domain Number 1 Region: 271-401
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 4.06e-43
Family Regulator of G-protein signaling, RGS 0.00000243
Further Details:      
 
Domain Number 2 Region: 2-96
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 3.21e-26
Family DEP domain 0.005
Further Details:      
 
Domain Number 3 Region: 198-259
Classification Level Classification E-value
Superfamily Transducin (heterotrimeric G protein), gamma chain 1.83e-17
Family Transducin (heterotrimeric G protein), gamma chain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A091UQB9
Sequence length 429
Comment (tr|A0A091UQB9|A0A091UQB9_NIPNI) Regulator of G-protein signaling 11 {ECO:0000313|EMBL:KFQ93179.1} KW=Complete proteome; Reference proteome OX=128390 OS=Nipponia nippon (Crested ibis) (Ibis nippon). GN=Y956_05182 OC=Nipponia.
Sequence
RQMERMIVSMQDPDMGIKMRNQRLLITVIPHAMTGNDIVEWLIQKYSISEEESLHLGNLI
VKHGYIYPLKDPRSLVLRADESPYRFQTPYFWTSTKWPATELDYAIYLAKKNIRKQGDLI
EHEKDNYNLLHKRINHTWDFVVMQAREQLRAAKQRRKGDRIVIDCQEQAYWLVNRPPPGA
PNVLEQGPARRNCHTTRVQLTKNMDYYKREIEYCRKAMARTRVKSSICLEGYIKFNEQYV
PHDPIMSGCLPSNPWITDDTTYWAMNAPTVPTPVKLRVERWGFNFSELLTDPLGRAQLLD
FLKKEFSAENLSFWEACEELRYGEQSRIPEIVDSIYQQFLAPGATRWVNIDSKTMERTLE
GIKTPHRYVMDDAQMHIYMLMKKDSYPRFLKSELYRNLLAEAVIPPETKKRVFPFMRKQR
HSSPSPALL
Download sequence
Identical sequences A0A091UQB9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]