SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091URY7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091URY7
Domain Number 1 Region: 76-218
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.16e-39
Family Regulator of G-protein signaling, RGS 0.00000019
Further Details:      
 
Domain Number 2 Region: 760-841
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.82e-27
Family DIX domain 0.0000136
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A091URY7
Sequence length 841
Comment (tr|A0A091URY7|A0A091URY7_NIPNI) Axin-1 {ECO:0000313|EMBL:KFQ93182.1} KW=Complete proteome; Reference proteome OX=128390 OS=Nipponia nippon (Crested ibis) (Ibis nippon). GN=Y956_05185 OC=Nipponia.
Sequence
MNIQGKGFPLDLGGSFTEDAPRPPVPGEEGELVSTDPRPVSHGFYSGKSDVVRNETSTAT
PRRSDLDLGYEPEGSASPTPPYLKWAESLHSLLDDQDGINLFRTFLKQEDCADLLDFWFA
CSGFRKLEPCTSNEEKRLKLAKAIYKKYILDNNGIVSRQIKPATKSFIKDCVVKLQIDPD
MFDQAQTEIQCMIEDNTYPLFLKSDIYLEYTRTGGESPKIYSDPSSGSGTGKGLPGYLPT
LNEDEEWKCDQEAEPEASRDSAPSSRLTQKLLLETATQRATSARRYSEGREFRHGSWREP
VNPYYVNTGYALAPATSANDSEQQSMSSDADTMSLTDSSVDGIPPYRLRKQHRREMQESA
KANGRVPLPHIPRTYRMPKDIHVEPEKFAAELINRLEEVQKEREAEEKLEERLKRVRAEE
EGEDADISSGPLVISHKMPSAQAFHHFAPRYSEMGCAGMQMRDAHEENPESILDEHVQRV
MKTPGCQSPGPGRHSPKPRSPESGHLGKLSGTLGTIPPGHGKHTTKSGMKLDAANLYHHK
HVYHHIHHHSVMKPKEQIEAEATQRVQNSFAWNVDSHNYATKSRNYTENLGMAPVPMDSL
GYSGKASLLSKRNVKKTDSGKSDGASYEMPGSPEDVERNQKILQWIIEGEKEISRHKKTN
HGSSGAKKQLSHDMVRPLSIERPVAVHPWVSAQLRNAVQPSHPFIQDPTMPPNPAPNPLT
QLEEARRRLEEEEKRAGKLPLKQRLKPQKRPGSGASQPCENIVVAYYFCGEPIPYRTLVK
GRVVTLGQFKELLTKKGNYRYYFKKVSDEFDCGVVFEEVREDDTILPIFEEKIIGKVEKI
D
Download sequence
Identical sequences A0A091URY7
XP_009475522.1.38621

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]