SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091UWE9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091UWE9
Domain Number 1 Region: 52-177
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.44e-45
Family Regulator of G-protein signaling, RGS 0.00000068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A091UWE9
Sequence length 178
Comment (tr|A0A091UWE9|A0A091UWE9_NIPNI) Regulator of G-protein signaling 4 {ECO:0000313|EMBL:KFQ95041.1} KW=Complete proteome; Reference proteome OX=128390 OS=Nipponia nippon (Crested ibis) (Ibis nippon). GN=Y956_03494 OC=Nipponia.
Sequence
MCKGLAALPATCLKSAKDMKHRLGFLLQKSDSCDYSSSQGKKEKMPSGQRVSQEEVRKWA
DSLENLIHHDRGLAAFRAFLKSEYSEENIEFWVSCEDYKKTKSPAKLSPKARKIYDEFIS
VQATKEVNLDSCTREKTSHNVLEPTLSCFDEAQRKIFTLMEKDSYRRFLKSPYYLDLV
Download sequence
Identical sequences A0A091UWE9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]