SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091UXL7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091UXL7
Domain Number 1 Region: 51-158
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.7e-39
Family Spermadhesin, CUB domain 0.00021
Further Details:      
 
Domain Number 2 Region: 182-241
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.23e-16
Family Spermadhesin, CUB domain 0.0015
Further Details:      
 
Domain Number 3 Region: 2-45
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000918
Family EGF-type module 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A091UXL7
Sequence length 242
Comment (tr|A0A091UXL7|A0A091UXL7_PHORB) Tolloid-like 1 {ECO:0000313|EMBL:KFQ82338.1} KW=Complete proteome; Reference proteome OX=9218 OS=Phoenicopterus ruber ruber. GN=N337_03184 OC=Phoenicopteridae; Phoenicopterus.
Sequence
FLDKDECSKDNGGCQHECINTVGSYVCQCRNGFVLHENKHDCKEAECEQKIHSPNGIITS
PNWPDKYPSRKECTWEISATPGQRVKLTFNEFEIEQHQECAYDHLEVFDGESEKSPILGR
LCGNKIPDPLIATGNKMFLRFISDASVQRKGFQATHSTECGGRLKAETKPKDLYSHAQFG
DNNYPVQADCDWLLVAERGCRVELMFQTFEVEEEADCGYDYVELFDGHDKTAVRLGRFCG
SG
Download sequence
Identical sequences A0A091UXL7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]