SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091UXQ6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091UXQ6
Domain Number 1 Region: 16-124
Classification Level Classification E-value
Superfamily Inhibitor of apoptosis (IAP) repeat 2.23e-34
Family Inhibitor of apoptosis (IAP) repeat 0.0000169
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A091UXQ6
Sequence length 147
Comment (tr|A0A091UXQ6|A0A091UXQ6_NIPNI) Baculoviral IAP repeat-containing protein 5.1 {ECO:0000313|EMBL:KFQ94775.1} KW=Complete proteome; Reference proteome OX=128390 OS=Nipponia nippon (Crested ibis) (Ibis nippon). GN=Y956_07489 OC=Nipponia.
Sequence
MEMLLKELGLASQLLSDFKDMYEYENRLKTFTNWPFIENCKCTPENMAKAGFVHCPNANE
PDVAKCFFCLIELEGWEPNDDPWEEHTKRHSCGFLSLTKHFDDLTMEEYYMLEMTRLRTF
LCKTGRRIINSFEEEVTATRQRLVDSF
Download sequence
Identical sequences A0A091UXQ6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]