SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091V0B7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091V0B7
Domain Number 1 Region: 73-235,292-343
Classification Level Classification E-value
Superfamily TPR-like 0.0000000000715
Family BTAD-like 0.085
Further Details:      
 
Domain Number 2 Region: 1-44
Classification Level Classification E-value
Superfamily HIT/MYND zinc finger-like 0.00000000014
Family MYND zinc finger 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A091V0B7
Sequence length 351
Comment (tr|A0A091V0B7|A0A091V0B7_NIPNI) Zinc finger MYND domain-containing protein 12 {ECO:0000313|EMBL:KFQ95720.1} KW=Complete proteome; Reference proteome OX=128390 OS=Nipponia nippon (Crested ibis) (Ibis nippon). GN=Y956_03164 OC=Nipponia.
Sequence
RCEVCGAGGRLRCGRCRLAYYCDVHHQKADWVSIHERICQLLIPIRTSVPFLLSEKERKH
GTEQLVKRQKYITELAYGTAQKFVLDGKHEEAIPAALHALRFGTEVYGSNSVQLVPAYLL
LAEASAGVGHLPEASRYLSQARWIVLSTPDCSAAVRYKLHRGLGLFCAAEGNFEQALYHL
ANDIYLASSTFGLKSLEASGGYFHMANVFFRQNKTDVANSLYAEVTDIWHAFLVKSVQAQ
EQIRESRPETSPFTEEKEVGEDPMTEAQQAEATRVLKAVLAVREQAPKPQPGETARVLHA
LAMLYYLVGELSKAREAGTKAFALVKQLPQQEAPEAIGHLLELVDSRPSPT
Download sequence
Identical sequences A0A091V0B7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]