SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091V2H9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091V2H9
Domain Number 1 Region: 88-261
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 4.19e-46
Family RNA editing terminal uridyl transferase 2, RET2, domain 2 0.0013
Further Details:      
 
Domain Number 2 Region: 9-84
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 0.0000000000752
Family RNA editing terminal uridyl transferase 2, RET2, catalytic domain 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A091V2H9
Sequence length 269
Comment (tr|A0A091V2H9|A0A091V2H9_PHORB) Poly(A) RNA polymerase GLD2 {ECO:0000313|EMBL:KFQ83983.1} KW=Complete proteome; Reference proteome OX=9218 OS=Phoenicopterus ruber ruber. GN=N337_10761 OC=Phoenicopteridae; Phoenicopterus.
Sequence
VNQKTEARHILSLVQKLFSTKLSSYIERPQLIRAKVPIVKFRDKNTMMLESFSFLFPNSC
VEFDLNVNNVVGIRNTFLLRTYACIEKRVRPLVLVVKKWANFHDINDASRGTLSSYSLVL
MVLHYLQTLPEPILPSLQKNYPDSFDPTMQLHLVHQAPCTIPPYLSKNGSSLGDLLIGFF
KYYATEFDWSHQMISVREAKAIPRPDGIEWRNKFICVEEPFDGTNTARAVHEKQKFDIIR
AEFLKSWQVLRDKKDLHCILPLRTTTQKR
Download sequence
Identical sequences A0A091V2H9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]