SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091V3B8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091V3B8
Domain Number 1 Region: 1-90
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.59e-36
Family Calponin-homology domain, CH-domain 0.0000048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A091V3B8
Sequence length 111
Comment (tr|A0A091V3B8|A0A091V3B8_PHORB) Microtubule-associated protein RP/EB family member 2 {ECO:0000313|EMBL:KFQ84273.1} KW=Complete proteome; Reference proteome OX=9218 OS=Phoenicopterus ruber ruber. GN=N337_02002 OC=Phoenicopteridae; Phoenicopterus.
Sequence
GAAYCQFMDMLFPGCISLKKVKFQAKLEHEYIHNFKLLQASFKRMNVDKVIPVEKLVKGR
FQDNLDFIQWFKKFFDANYDGKEYDPVEARQGQDALPPPDPGEQIFNLPKK
Download sequence
Identical sequences A0A091V3B8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]