SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091V5U3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091V5U3
Domain Number 1 Region: 267-398
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 3.01e-44
Family Regulator of G-protein signaling, RGS 0.000000231
Further Details:      
 
Domain Number 2 Region: 2-96
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.01e-25
Family DEP domain 0.012
Further Details:      
 
Domain Number 3 Region: 201-258
Classification Level Classification E-value
Superfamily Transducin (heterotrimeric G protein), gamma chain 0.0000000000000929
Family Transducin (heterotrimeric G protein), gamma chain 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A091V5U3
Sequence length 633
Comment (tr|A0A091V5U3|A0A091V5U3_NIPNI) Regulator of G-protein signaling 9 {ECO:0000313|EMBL:KFQ98701.1} KW=Complete proteome; Reference proteome OX=128390 OS=Nipponia nippon (Crested ibis) (Ibis nippon). GN=Y956_08472 OC=Nipponia.
Sequence
QIEALMMEMQNPDTGIKTQTQRVMITNIPHAVAGNDILQWILQRLQITEEEALHLGDLFV
KYGYIYPLQEPKNLTLKTDGSLYRFQTPYFWPAQSWPADDTDYAIYLAKKNIKRKGILEE
YEKEHYNMLNQKINYKWDFVIMQAKEQYKAGKERKKADRYALDCQERAYWLVNRTPPGML
DVLEYGLDRVTDPNENKKKTMDVYRREIMYYQQAIMKSRVKSSVSLGGLVKYSEQFLSND
PILSGCLPSNPWITDDPEFWDLNAKLVEIPTRMRVERWAFNFSELIRDPKGRQNFQLFLK
KEFSGENLSFWEACEDLKYGDQSKVKEKAEEIYKLFLAPGARRWINIDGTTMGITVKGLK
HPHRYVLDAAQTHIYMLMKKDSYGRYLKSPIYKEMLSKAVVPQETVKKSSAFPFGRRHLR
SSPSPVILRQQEEEAKAKEAATTVDITQPCHLASPAPHPAVYAGTGTPPSPPACLPPGPP
ALPHSTACPSPISVALDSTTGTEWEREPEGASLGHGPGPFPSSSGKSRTAALSFSRFLKR
GCWTSPVFATLSPKCPAVPHGKVQPLGERERRLRPDAKVVSSFFQIKMDAPLESRIYPLD
SEKGEDNCHRARKDSAKEVICPWENPTEEGRAG
Download sequence
Identical sequences A0A091V5U3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]