SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091V8B2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091V8B2
Domain Number 1 Region: 187-295
Classification Level Classification E-value
Superfamily Cystine-knot cytokines 8.17e-43
Family Transforming growth factor (TGF)-beta 0.0000021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A091V8B2
Sequence length 296
Comment (tr|A0A091V8B2|A0A091V8B2_OPIHO) Bone morphogenetic protein 6 {ECO:0000313|EMBL:KFQ98632.1} KW=Complete proteome; Reference proteome OX=30419 OS=Opisthocomus hoazin (Hoatzin) (Phasianus hoazin). GN=N306_10617 OC=Opisthocomus.
Sequence
FPSAVEYDKEFTPHQRHHKEFKFNLSQIPEGEAVTAAEFRIYKDCVVGSFKNQTFLISIY
QVLQEHQNRASDLFLLDTRVVWASEEGWLEFDVTATSNMWVMNPQQNMGLQLSVVTRDGF
SVNPREAGLIGRDGPYDKQPFMVAFFKVSEVHVRTTRSATSRRRQQSRNRSTQAQDVSRV
SSVTDYNSSDLKTACRKHELYVSFQDLGWQDWIIAPKGYAANYCDGECSFPLNAHMNATN
HAIVQTLVHLMNPDYVPKPCCAPTKLNAISVLYFDDNSNVILKKYRNMVVRACGCH
Download sequence
Identical sequences A0A091V8B2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]